Request QuoteCatalog Number: xP308828MOSize: 0.2-1mg

Request Quote

Recombinant Developmental pluripotency-associated protein 5B/5C (Dppa5b)

Recombinant Developmental pluripotency-associated protein 5B/5C (Dppa5b) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP308828MOYeast1mgQuote
EP308828MOE. coli1mgQuote
BP308828MOBaculovirus200ugQuote
MP308828MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP85965
Gene NameDppa5b ANDDppa5c
Protein NameDevelopmental pluripotency-associated protein 5B/5C
Region Expressed1-119
Expression Tag6xHis
Purity>90%
AA SequenceMMVTLVTRKDIPPWVKVPEDLTDPEVFQVQSLVLKYLFGPQGSRMSHIEQVSQAMFELKN LESPEELIEVFIYGYQSIKVRAKWLLQSMAERYHLRQQKRPSLTTFWEFGGPDVSLKEC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review