Request QuoteCatalog Number: xP372131BOSize: 0.2-1mg

Request Quote

Recombinant Coiled-coil domain-containing protein 167 (CCDC167)

Recombinant Coiled-coil domain-containing protein 167 (CCDC167) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP372131BOYeast1mgQuote
EP372131BOE. coli1mgQuote
BP372131BOBaculovirus200ugQuote
MP372131BOMammalian Cell200ugQuote

Protein Information

SpeciesBos taurus (Bovine)
UniProt IDA1A4P9
Gene NameCCDC167
Protein NameCoiled-coil domain-containing protein 167
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMTKKKRENLGVALEIDGLEKKLSQCRRDLEVVNSRLCGVELSSEARRSLEKEKSSLMNKA SNYEKELKLLRQENRKNMLLSVAIFLLLTVIYAYWAL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review