Request QuoteCatalog Number: xP355778MOSize: 0.2-1mg

Request Quote

Recombinant H-2 class I histocompatibility antigen, alpha chain

Recombinant H-2 class I histocompatibility antigen, alpha chain can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP355778MOYeast1mgQuote
EP355778MOE. coli1mgQuote
BP355778MOBaculovirus200ugQuote
MP355778MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDP01896
Gene Name
Protein NameH-2 class I histocompatibility antigen, alpha chain
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceWLHRYLKNGNATLLRTDPPKAHVTHHRRPEGDVTLRCWALGFYPADITLTWQLNGEELTQ DMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRWEPPPSTDSYM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review