Class B acid phospha-->

Request QuoteCatalog Number: xP520455HTCSize: 0.2-1mg

Recombinant Class B acid phosphatase (aphA)

Recombinant Class B acid phosphatase (aphA) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number	Expression Host	Amount	In Stock
YP520455HTC	Yeast	1mg	Quote
EP520455HTC	E. coli	1mg	Quote
BP520455HTC	Baculovirus	200ug	Quote
MP520455HTC	Mammalian Cell	200ug	Quote

Protein Information

Species	Haemophilus parainfluenzae (strain T3T1)
UniProt ID	E1W3A7
Gene Name	aphA; Locus:PARA_07400
Protein Name	Class B acid phosphatase
Region Expressed	23-235
Expression Tag	6xHis
Purity	>90%
AA Sequence	SNKEPYTEQGTNAREMTEQKPIHWISVEQLKKELEGKAPINVSFDIDDTVLFSSPCFYHG QEKYSPGKNDYLKNQDFWNEVNAGCDQYSIPKQIAVDLINMHQARGDQIYFITGRTAGDK DGVTPVLQKAFNIKDMHPVEFMGGRKLPTKYNKTPGIIEHKVSIHYGDSDDDILAAKEAG IRGIRLMRAANSTYQPMPTLGGYGEEVLINSNY
Storage Buffer	PBS pH 7.4, 50% glycerol
Storage	Store working aliquots at 4^oC for upto a week. Freeze at -20 to -80^oC for long term storage. Avoid repeated freeze/thaw.

Request Quote

ReviewsWrite Review

Products