Request QuoteCatalog Number: xP522200SXCSize: 0.2-1mg

Request Quote

Recombinant Chaperone protein sicP (sicP)

Recombinant Chaperone protein sicP (sicP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522200SXCYeast1mgQuote
EP522200SXCE. coli1mgQuote
BP522200SXCBaculovirus200ugQuote
MP522200SXCMammalian Cell200ugQuote

Protein Information

SpeciesSalmonella typhimurium (strain SL1344)
UniProt IDE1WAC4
Gene NamesicP; Locus:SL1344_2859
Protein NameChaperone protein sicP
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMGLPLTFDDNNQCLLLLDSDIFTSIEAKDDIWLLNGMIIPLSPVCGDSIWRQIMVINGEL AANNEGTLAYIDAAETLLLIHAITDLTNTYHIISQLESFVNQQEALKNILQEYAKV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review