Request QuoteCatalog Number: xP329627PISize: 0.2-1mg

Request Quote

Recombinant Carbohydrate-binding protein AQN-1

Recombinant Carbohydrate-binding protein AQN-1 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP329627PIYeast1mgQuote
EP329627PIE. coli1mgQuote
BP329627PIBaculovirus200ugQuote
MP329627PIMammalian Cell200ugQuote

Protein Information

SpeciesSus scrofa (Pig)
UniProt IDP26322
Gene Name
Protein NameCarbohydrate-binding protein AQN-1
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceAQNKGPHKCGGVLRNYSGRISTYEGPKTDCIWTILAKPGSRVFVAIPYLNLACGKEYVEV QDGLPGAGNYGKLCSGIGLTYQSSSNALSIKYSRTAGHSASSFDIYYYGDS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review