Request QuoteCatalog Number: xP529584GUSize: 0.2-1mg

Request Quote

Recombinant cAMP-specific 3',5'-cyclic phosphodiesterase 4A (PDE4A)

Recombinant cAMP-specific 3',5'-cyclic phosphodiesterase 4A (PDE4A) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529584GUYeast1mgQuote
EP529584GUE. coli1mgQuote
BP529584GUBaculovirus200ugQuote
MP529584GUMammalian Cell200ugQuote

Protein Information

SpeciesCavia porcellus (Guinea pig)
UniProt IDO89085
Gene NamePDE4A
Protein NamecAMP-specific 3',5'-cyclic phosphodiesterase 4A
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequencePWLVGWWDQFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEIPSPTMKDREPQE APRQRPCQQLPPPVPHLQPMSQITGVKRLSHNSGLNNASIPRFGVKTDQEELLAQEL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review