Request QuoteCatalog Number: xP012078RASize: 0.2-1mg

Request Quote

Recombinant Calcium-activated potassium channel subunit beta-1 (Kcnmb1)

Recombinant Calcium-activated potassium channel subunit beta-1 (Kcnmb1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP012078RAYeast1mgQuote
EP012078RAE. coli1mgQuote
BP012078RABaculovirus200ugQuote
MP012078RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP97678
Gene NameKcnmb1
Protein NameCalcium-activated potassium channel subunit beta-1
Region Expressed40-155
Expression Tag6xHis
Purity>90%
AA SequencePLYQKSVWTQESTCHLVETNIKDQEELEGRKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQ NQQCSYIPRNLDNYQTALVDVKKVRANFYKHHNFYCFSAPQVNETSVVYQRLYGPQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review