Request QuoteCatalog Number: xP002740RBSize: 0.2-1mg

Request Quote

Recombinant Bone morphogenetic protein 4 (BMP4)

Recombinant Bone morphogenetic protein 4 (BMP4) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002740RBYeast1mgQuote
EP002740RBE. coli1mgQuote
BP002740RBBaculovirus200ugQuote
MP002740RBMammalian Cell200ugQuote

Protein Information

SpeciesOryctolagus cuniculus (Rabbit)
UniProt IDO46576
Gene NameBMP4; aka: BMP-4
Protein NameBone morphogenetic protein 4
Region Expressed294-409
Expression Tag6xHis
Purity>90%
AA SequenceSLKHHPQRARKKNKNCRRHALYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHFNST NHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review