P16860

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.

The protein was lyophilized without additives.

Sterile Filtered White lyophilized (freeze-dried) powder.

Greater than 98.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H₂O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18^oC. Upon reconstitution B-type Natriuretic Peptide should be stored at 4^oC between 2-7 days and for future use below -18^oC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.