Request QuoteCatalog Number: xP513180SVNSize: 0.2-1mg

Request Quote

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLI1 (BLI1)

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLI1 (BLI1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513180SVNYeast1mgQuote
EP513180SVNE. coli1mgQuote
BP513180SVNBaculovirus200ugQuote
MP513180SVNMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
UniProt IDC8ZCB1
Gene NameBLI1; ORFs:EC1118_1K5_1849g
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit BLI1
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMGEQNKLYYDVEKLVNSLQESFDLDCAQSVSLFTSKSRSNEAWLEELENKFKLKDDVELD DVENLRAEIDMKLNMLEDKVSYYERLYKELEEFQNEIKIKTVVNNRRQSRTPK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review

Products