Request QuoteCatalog Number: xP515239SVRSize: 0.2-1mg

Request Quote

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLS1 (BLS1)

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLS1 (BLS1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP515239SVRYeast1mgQuote
EP515239SVRE. coli1mgQuote
BP515239SVRBaculovirus200ugQuote
MP515239SVRMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Zymaflore VL3) (Baker's yeast)
UniProt IDE7QIC5
Gene NameBLS1; ORFs:VL3_3442
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit BLS1
Region Expressed1-122
Expression Tag6xHis
Purity>90%
AA SequenceMFLTFSMCVNWIIVKMPNRSEELDRLLDKIINSPHRTEASKTLQEIENNQSYILNVQLKK LLRLHDDSFKNKCVSPINYMLEKYTPYMGHTEALQKEAELVDRDLRILEMTYQLIEKNRN SK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review