Request QuoteCatalog Number: xP518965SVJSize: 0.2-1mg

Request Quote

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLI1 (BLI1)

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLI1 (BLI1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518965SVJYeast1mgQuote
EP518965SVJE. coli1mgQuote
BP518965SVJBaculovirus200ugQuote
MP518965SVJMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain FostersB) (Baker's yeast)
UniProt IDE7Q653
Gene NameBLI1; ORFs:FOSTERSB_2857
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit BLI1
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMGEQNKLYYDVEKLVNSLQESFDLDCAQSVSLFTSKSRSNEAWLEELENKFKLKDDVELD DVENLRAEIDMKLNMLEDKVSYYERLYKELEEFQNEIKIKTVVNNRRQSRTPK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review