Request QuoteCatalog Number: xP517210SVOSize: 0.2-1mg

Request Quote

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit CNL1 (CLN1)

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit CNL1 (CLN1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517210SVOYeast1mgQuote
EP517210SVOE. coli1mgQuote
BP517210SVOBaculovirus200ugQuote
MP517210SVOMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin QA23) (Baker's yeast)
UniProt IDE7KM17
Gene NameCLN1; ORFs:QA23_1057
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit CNL1
Region Expressed1-122
Expression Tag6xHis
Purity>90%
AA SequenceMQDNSSHSRESASAGDDPLGIDKLTVDYDYLLYKIRDYVQSIQLDTTELCKKQNEVMVNG IIENTIDKNIAKFKELLEKCDTLENHYEMLNQLAIITDTFKERIAEAVNNYNXLKKGASK SK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review