Request QuoteCatalog Number: xP517208SVISize: 0.2-1mg

Request Quote

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLI1 (BLI1)

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit BLI1 (BLI1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517208SVIYeast1mgQuote
EP517208SVIE. coli1mgQuote
BP517208SVIBaculovirus200ugQuote
MP517208SVIMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain AWRI796) (Baker's yeast)
UniProt IDE7KEX7
Gene NameBLI1; ORFs:AWRI796_2899
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit BLI1
Region Expressed1-113
Expression Tag6xHis
Purity>90%
AA SequenceMGEQNKLYYDVEKLVNSLQESFDLDCAQSVSLFTSKSRSNEAWLEELENKFKLKDDVELD DVENLRAEIDMKLNMLEDKVSYYERLYKELEEFQNEIKIKTVVNNRRQSRTPK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review