Request QuoteCatalog Number: xP002718DOASize: 0.2-1mg

Request Quote

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit 1 (BLOS1)

Recombinant Biogenesis of lysosome-related organelles complex 1 subunit 1 (BLOS1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP002718DOAYeast1mgQuote
EP002718DOAE. coli1mgQuote
BP002718DOABaculovirus200ugQuote
MP002718DOAMammalian Cell200ugQuote

Protein Information

SpeciesArabidopsis thaliana (Mouse-ear cress)
UniProt IDO22929
Gene NameBLOS1; aka: GCN5L1; Locus:At2g30330; ORFs:T09D09.14
Protein NameBiogenesis of lysosome-related organelles complex 1 subunit 1
Region Expressed1-152
Expression Tag6xHis
Purity>90%
AA SequenceMNTPMSLSAARGRMLPFLEKEKSEEESETLESSLLQLIDDNRRSSLQLREKTERSRKEAI RHAARTADLLVKAVNGGVEECFVNEKRIESEIRNLAITVAKFGKQTDQWLAVTHAVNSAV KEIGDFENWMKTMEFDCKKITAAIRNIHEDQQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review