MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG
ASSPAPRTALQPQESVGAGAGEAALPLPG.
Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1000-5000ng/ml corresponding to a Specific Activity of 200-1000IU/mg in the presence of 1.0ug/ml of human soluble BAFF.
Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Sterile Filtered White lyophilized (freeze-dried) powder.
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18oC. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4oC between 2-7 days and for future use below -18oC.
Please prevent freeze-thaw cycles.
TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
