Request QuoteCatalog Number: xP512150FKBSize: 0.2-1mg

Request Quote

Recombinant ATP-dependent zinc metalloprotease FtsH 4 (ftsh4)

Recombinant ATP-dependent zinc metalloprotease FtsH 4 (ftsh4) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP512150FKBYeast1mgQuote
EP512150FKBE. coli1mgQuote
BP512150FKBBaculovirus200ugQuote
MP512150FKBMammalian Cell200ugQuote

Protein Information

SpeciesSphaerobacter thermophilus (strain DSM 20745 / S 6022)
UniProt IDD1C8C0
Gene Nameftsh4; Locus:Sthe_2649
Protein NameATP-dependent zinc metalloprotease FtsH 4
Region Expressed50-149
Expression Tag6xHis
Purity>90%
AA SequenceSSGARLNIPYSAFIQQVEGENVSSVTIRGQRVSGTFTEEVRVAGDQVLSPGDPVPPGTSP NEIRTGTQFQTTIPENSQTELVPLLQSHGVTVKIDQAGGS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review