Request QuoteCatalog Number: xP514130DVOSize: 0.2-1mg

Request Quote

Recombinant ATP-dependent zinc metalloprotease FtsH 3 (ftsH3)

Recombinant ATP-dependent zinc metalloprotease FtsH 3 (ftsH3) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514130DVOYeast1mgQuote
EP514130DVOE. coli1mgQuote
BP514130DVOBaculovirus200ugQuote
MP514130DVOMammalian Cell200ugQuote

Protein Information

SpeciesConexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577)
UniProt IDD3EZK2
Gene NameftsH3; Locus:Cwoe_5435
Protein NameATP-dependent zinc metalloprotease FtsH 3
Region Expressed97-186
Expression Tag6xHis
Purity>90%
AA SequencePSERVRVPYSPNFIQQVRDGNVKEISSTGASIQGDFRADVTYPPKDDKDSVTAKKFSTEV PAFADTDELSKLLQDNDVTVNASPADNGPS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review