Request QuoteCatalog Number: xP503848RMNSize: 0.2-1mg

Request Quote

Recombinant Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C

Recombinant Aspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP503848RMNYeast1mgQuote
EP503848RMNE. coli1mgQuote
BP503848RMNBaculovirus200ugQuote
MP503848RMNMammalian Cell200ugQuote

Protein Information

SpeciesRickettsia africae (strain ESF-5)
UniProt IDC3PMJ1
Gene NamegatC; Locus:RAF_ORF0184
Protein NameAspartyl/glutamyl-tRNA (Asn/Gln) amidotransferase subunit C
Region Expressed1-100
Expression Tag6xHis
Purity>90%
AA SequenceMITKEEAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNAR MREDAVTSSDLSSELFDNVSGNSTQLAKEVKYFITPKVVE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review