Request QuoteCatalog Number: xP513234FIMSize: 0.2-1mg

Request Quote

Recombinant Arginine biosynthesis bifunctional protein ArgJ, mitochondrial (SMAC_03990)

Recombinant Arginine biosynthesis bifunctional protein ArgJ, mitochondrial (SMAC_03990) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP513234FIMYeast1mgQuote
EP513234FIME. coli1mgQuote
BP513234FIMBaculovirus200ugQuote
MP513234FIMMammalian Cell200ugQuote

Protein Information

SpeciesSordaria macrospora (strain ATCC MYA-333 / DSM 997 / K (L3346) / K-hell)
UniProt IDD1ZHR9
Gene NameORFs:SMAC_03990
Protein NameArginine biosynthesis bifunctional protein ArgJ, mitochondrial Cleaved into the following 2 chains: 1. Arginine biosynthesis bifunctional protein ArgJ alpha chain 2. Arginine biosynthesis bifunctional protein ArgJ beta chain 3. Including the following 2 domains: 4. Glutamate N-acetyltransferase
Region Expressed239-469
Expression Tag6xHis
Purity>90%
AA SequenceTLLGIIATDAPVSSTVLPAVLKHAVDRSFNSITIDGDTSTNDTVALLANGAAGGKEVVAN TPDYDAFQTVLTDFSTDLAKLIVRDGEGATKFVTIRVVEAASEEAARKIASTIARSPLVK TALYGKDANWGRILCATGYSLVSEPGLPVNDIPEVVPEKTNVSFIPTDGTAELKLLVNGE PEQVDEARAAEILELEDLEILVRLGTGDKQATYWTCDYSHEYITINGDYRT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review