Request QuoteCatalog Number: xP514984VESSize: 0.2-1mg

Request Quote

Recombinant Arginine biosynthesis bifunctional protein ArgJ, mitochondrial (VDBG_00178)

Recombinant Arginine biosynthesis bifunctional protein ArgJ, mitochondrial (VDBG_00178) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514984VESYeast1mgQuote
EP514984VESE. coli1mgQuote
BP514984VESBaculovirus200ugQuote
MP514984VESMammalian Cell200ugQuote

Protein Information

SpeciesVerticillium albo-atrum (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt)
UniProt IDC9S923
Gene NameORFs:VDBG_00178
Protein NameArginine biosynthesis bifunctional protein ArgJ, mitochondrial Cleaved into the following 2 chains: 1. Arginine biosynthesis bifunctional protein ArgJ alpha chain 2. Arginine biosynthesis bifunctional protein ArgJ beta chain 3. Including the following 2 domains: 4. Glutamate N-acetyltransferase
Region Expressed233-464
Expression Tag6xHis
Purity>90%
AA SequenceTLLGVVATDAPIAPGVMPSVLKHAVDRSFNSITIDGDTSTNDTVALLANGAAGGQEISSV DSPDYAAFQTVLSDFSADLAKLIVRDGEGATKFVTIRVVDSASEEAARKVASTIARSPLV KTALYGRDANWGRILCATGYALISEPGQDINEVASIVSEKTNVSFVPTDGSAELKLLVNG EPETVDEARASEILELEDLEILVKLGTGDKQATYWTCDYSHEYITINGDYRT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review