Request QuoteCatalog Number: xP514713FJSSize: 0.2-1mg

Request Quote

Recombinant Arginine biosynthesis bifunctional protein ArgJ, chloroplastic (Sb01g039230)

Recombinant Arginine biosynthesis bifunctional protein ArgJ, chloroplastic (Sb01g039230) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514713FJSYeast1mgQuote
EP514713FJSE. coli1mgQuote
BP514713FJSBaculovirus200ugQuote
MP514713FJSMammalian Cell200ugQuote

Protein Information

SpeciesSorghum bicolor (Sorghum) (Sorghum vulgare)
UniProt IDC5WPC2
Gene NameLocus:Sb01g039230
Protein NameArginine biosynthesis bifunctional protein ArgJ, chloroplastic Cleaved into the following 2 chains: 1. Arginine biosynthesis bifunctional protein ArgJ alpha chain 2. Arginine biosynthesis bifunctional protein ArgJ beta chain 3. Including the following 2 domains: 4. Glutamate N-acetyltransferase
Region Expressed245-464
Expression Tag6xHis
Purity>90%
AA SequenceTMLGVLTTDAQVSNDVWREMVRTSVSRSFNQITVDGDTSTNDCVIAMASGLSGLSRIQSL DSIEAQQFQACLDAVMQGLAKSIAWDGEGATCLIEVTVSGANNEAEAAKIARSVASSSLV KAAVFGRDPNWGRIACSVGYSGIQFDANRLDISLGVIPLMKNGQPLPFDRSAASRYLKDA GDAHGTVNIDISVGSGGGNGKAWGCDLSYKYVEINAEYTT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review