Request QuoteCatalog Number: xP009183HUSize: 0.2-1mg

Request Quote

Recombinant G antigen 2E (GAGE2E)

Recombinant G antigen 2E (GAGE2E) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP009183HUYeast1mgQuote
EP009183HUE. coli1mgQuote
BP009183HUBaculovirus200ugQuote
MP009183HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDQ4V326
Gene NameGAGE2E
Protein NameG antigen 2E
Region Expressed1-116
Expression Tag6xHis
Purity>90%
AA SequenceMSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGED EGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGKKQSQC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review