Request QuoteCatalog Number: xP009178HUSize: 0.2-1mg

Request Quote

Recombinant G antigen 13 (GAGE13)

Recombinant G antigen 13 (GAGE13) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP009178HUYeast1mgQuote
EP009178HUE. coli1mgQuote
BP009178HUBaculovirus200ugQuote
MP009178HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDQ4V321
Gene NameGAGE13; aka: GAGE12A
Protein NameG antigen 13
Region Expressed1-117
Expression Tag6xHis
Purity>90%
AA SequenceMSWRGRSTYYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGE DEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGKKQSQC
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review