Request QuoteCatalog Number: xP514971SVNSize: 0.2-1mg

Request Quote

Recombinant Altered inheritance of mitochondria protein 34, mitochondrial (AIM34)

Recombinant Altered inheritance of mitochondria protein 34, mitochondrial (AIM34) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP514971SVNYeast1mgQuote
EP514971SVNE. coli1mgQuote
BP514971SVNBaculovirus200ugQuote
MP514971SVNMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
UniProt IDC8ZEK9
Gene NameAIM34; ORFs:EC1118_1M3_1607g
Protein NameAltered inheritance of mitochondria protein 34, mitochondrial
Region Expressed56-198
Expression Tag6xHis
Purity>90%
AA SequenceHLSFLMNNNDITPFQKFTVKVLKEQCKSRGLKLSGRKSDLLQRLITHDSCSNKKSSVKIN EPKKKRILINDPIKITKKLVSDKTFRTIEKNISSLQNTPVIETPCDVHSHLQPRDRIFLL GFFMLSCLWWNLEPQESKPTIDH
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review