Request QuoteCatalog Number: xP512102SVNSize: 0.2-1mg

Request Quote

Recombinant Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Recombinant Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP512102SVNYeast1mgQuote
EP512102SVNE. coli1mgQuote
BP512102SVNBaculovirus200ugQuote
MP512102SVNMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
UniProt IDC8ZEH4
Gene NameAIM31; ORFs:EC1118_1M3_1200g
Protein NameAltered inheritance of mitochondria protein 31, mitochondrial
Region Expressed1-159
Expression Tag6xHis
Purity>90%
AA SequenceMSRMPSSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVRLGNKWKA QYYFRWRVGLQAATLVALVAGSFIYGTSGKELKAKEEQLKEKAKMREKLWIQELERREEE TEARRKRAELARMKTLENEEEIKNLEKELSDLENKLGKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review