Request QuoteCatalog Number: xP522394GGUSize: 0.2-1mg

Request Quote

Recombinant Alcohol dehydrogenase 15 kDa subunit (adhS)

Recombinant Alcohol dehydrogenase 15 kDa subunit (adhS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP522394GGUYeast1mgQuote
EP522394GGUE. coli1mgQuote
BP522394GGUBaculovirus200ugQuote
MP522394GGUMammalian Cell200ugQuote

Protein Information

SpeciesGluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)
UniProt IDO05544
Gene NameadhS; Locus:GOX0756
Protein NameAlcohol dehydrogenase 15 kDa subunit
Region Expressed25-133
Expression Tag6xHis
Purity>90%
AA SequenceQEQSPPPPPAVQGTPGKDFTGVSPANLAGIMNYCVEQQYVSYDEGNPVLYGLSEKYKATE QTVGNFDYALGTAGYFDSNGKRFYLVAYTNEDDRRAACHAAVKAAQPML
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review