Request QuoteCatalog Number: xP001462HUSize: 0.2-1mg

Request Quote

Recombinant Agouti-related protein (AGRP)

Recombinant Agouti-related protein (AGRP) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001462HUYeast1mgQuote
EP001462HUE. coli1mgRPB302Hu01; RP056944h
BP001462HUBaculovirus200ugQuote
MP001462HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO00253
Gene NameAGRP; aka: AGRT, ART
Protein NameAgouti-related protein
Region Expressed21-132
Expression Tag6xHis
Purity>90%
AA SequenceAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDRE PRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review