Request QuoteCatalog Number: xP001139DOASize: 0.2-1mg

Request Quote

Recombinant Acyl-CoA-binding domain-containing protein 6 (ACBP6)

Recombinant Acyl-CoA-binding domain-containing protein 6 (ACBP6) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001139DOAYeast1mgQuote
EP001139DOAE. coli1mgQuote
BP001139DOABaculovirus200ugQuote
MP001139DOAMammalian Cell200ugQuote

Protein Information

SpeciesArabidopsis thaliana (Mouse-ear cress)
UniProt IDP57752
Gene NameACBP6; Locus:At1g31812; ORFs:F5M6.27
Protein NameAcyl-CoA-binding domain-containing protein 6
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAW KAVEGKSSEEAMNDYITKVKQLLEVAASKAST
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review