Request QuoteCatalog Number: xP001257RASize: 0.2-1mg

Request Quote

Recombinant Activin receptor type-1 (Acvr1)

Recombinant Activin receptor type-1 (Acvr1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP001257RAYeast1mgQuote
EP001257RAE. coli1mgQuote
BP001257RABaculovirus200ugQuote
MP001257RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP80201
Gene NameAcvr1; aka: Acvrlk2
Protein NameActivin receptor type-1
Region Expressed21-123
Expression Tag6xHis
Purity>90%
AA SequenceMEDEEPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSVNDGFRVYQKGCFQVYEQGKMT CKTPPSPGQAVECCQGDWCNRNVTARLPTKGKSFPGSQNFHLE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review