Request QuoteCatalog Number: xP010741HUSize: 0.2-1mg

Request Quote

Recombinant Activator of apoptosis harakiri (HRK)

Recombinant Activator of apoptosis harakiri (HRK) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP010741HUYeast1mgQuote
EP010741HUE. coli1mgQuote
BP010741HUBaculovirus200ugQuote
MP010741HUMammalian Cell200ugQuote

Protein Information

SpeciesHomo sapiens (Human)
UniProt IDO00198
Gene NameHRK; aka: BID3
Protein NameActivator of apoptosis harakiri
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAP APGALPTYWPWLCAAAQVAALAAWLLGRRNL
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review