Request QuoteCatalog Number: xP529764EWPSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L44 (RPL44)

Recombinant 60S ribosomal protein L44 (RPL44) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529764EWPYeast1mgQuote
EP529764EWPE. coli1mgQuote
BP529764EWPBaculovirus200ugQuote
MP529764EWPMammalian Cell200ugQuote

Protein Information

SpeciesPlasmodium falciparum (isolate 3D7)
UniProt IDO97231
Gene NameRPL44; ORFs:MAL3P2.9, PFC0200W
Protein Name60S ribosomal protein L44
Region Expressed2-104
Expression Tag6xHis
Purity>90%
AA SequenceVNVPKTRKTYCSNKCKKHTMHKVSQYKKGKERLSSLGRRRYDMKQKGFGGQTKPVFKKKA KTTKKIVLKLECTKCKKKRFQTMKRCKTFEMGADKKKKGGAVY
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review