Request QuoteCatalog Number: xP518642SXVSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L34-A (rpl34a)

Recombinant 60S ribosomal protein L34-A (rpl34a) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP518642SXVYeast1mgQuote
EP518642SXVE. coli1mgQuote
BP518642SXVBaculovirus200ugQuote
MP518642SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDO42846
Gene Namerpl34a; aka: rpl34, rpl3401; ORFs:SPAC23A1.08c
Protein Name60S ribosomal protein L34-A
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMAQRVTYRRRLAYNTRSNRTRIIKTPGNNIRYLHIKKLGTIPRCGDTGVPLQGIPALRPR EFARLSHNKKTVQRAYGGCLSANAVKDRIVRAFLIEEQKIVKQKLKQLSSQK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review