Request QuoteCatalog Number: xP020227EVMSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L31 (RPL31)

Recombinant 60S ribosomal protein L31 (RPL31) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020227EVMYeast1mgQuote
EP020227EVME. coli1mgQuote
BP020227EVMBaculovirus200ugQuote
MP020227EVMMammalian Cell200ugQuote

Protein Information

SpeciesPicea mariana (Black spruce) (Abies mariana)
UniProt IDO65071
Gene NameRPL31; aka: SB42
Protein Name60S ribosomal protein L31
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMVEKGKSRRNEVATREYTINLHRRLHGCTFKKMAPKAVKEIRKFAQKAMGTTDVRLDVKL NKAVWSRGIRSVPRRMRVRISRKRNDEEDAKDELYSIVTVAEVPPEGLTGLGTKIIEEED
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review