Request QuoteCatalog Number: xP020267DYKSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L37a (RPL37A)

Recombinant 60S ribosomal protein L37a (RPL37A) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020267DYKYeast1mgQuote
EP020267DYKE. coli1mgQuote
BP020267DYKBaculovirus200ugQuote
MP020267DYKMammalian Cell200ugQuote

Protein Information

SpeciesCryptochiton stelleri (Giant gumboot chiton)
UniProt IDO61462
Gene NameRPL37A
Protein Name60S ribosomal protein L37a
Region Expressed2-92
Expression Tag6xHis
Purity>90%
AA SequenceAKRTKKVGIVGKYGTRYGASLRKTVKKMEITQHSKYTCQFCGKDAMKRQAVGIWGCKSCR KVVAGGAWVYSTMAAVTVRSAVRRLREMKES
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review