Request QuoteCatalog Number: xP020225ZAXSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L30 (RPL30)

Recombinant 60S ribosomal protein L30 (RPL30) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020225ZAXYeast1mgQuote
EP020225ZAXE. coli1mgQuote
BP020225ZAXBaculovirus200ugQuote
MP020225ZAXMammalian Cell200ugQuote

Protein Information

SpeciesZea mays (Maize)
UniProt IDO48558
Gene NameRPL30
Protein Name60S ribosomal protein L30
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMVATKKTKKSTDNINNKLQLVMKSGKYTLGYKTVLRTLRNSKSKLVIIANNCPPLRKSEI EYYAMLAKVTVHHFHGNNVDLGTACGKYFRVCCLSIIDPGDSDIIKTTPGEQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review