Request QuoteCatalog Number: xP020301EKMSize: 0.2-1mg

Request Quote

Recombinant 60S ribosomal protein L6 (RPL6)

Recombinant 60S ribosomal protein L6 (RPL6) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020301EKMYeast1mgQuote
EP020301EKME. coli1mgQuote
BP020301EKMBaculovirus200ugQuote
MP020301EKMMammalian Cell200ugQuote

Protein Information

SpeciesEntamoeba histolytica
UniProt IDO15595
Gene NameRPL6
Protein Name60S ribosomal protein L6
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceSAPQWFVPVKAGDAKVPAYYPTDDMIQEQKKKLRTRKGAKITALDKPGWNLEKLRKSIVP GAILIIVGGKYAGKKVVSLPSQGVSSAPLIAT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review