Request QuoteCatalog Number: xP020340LOHSize: 0.2-1mg

Request Quote

Recombinant 60S acidic ribosomal protein P1

Recombinant 60S acidic ribosomal protein P1 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020340LOHYeast1mgQuote
EP020340LOHE. coli1mgQuote
BP020340LOHBaculovirus200ugQuote
MP020340LOHMammalian Cell200ugQuote

Protein Information

SpeciesLeishmania peruviana
UniProt IDO46313
Gene Name
Protein Name60S acidic ribosomal protein P1
Region Expressed1-107
Expression Tag6xHis
Purity>90%
AA SequenceMTTETLACTYAALMLSDAGLPTSAENIAAAVKAAGVSVRPTMPIIFARFLEKKSVEALMA AAATQAPTATSAAAAPAAGEASGKAEEKKKEEPEEEGDDDMGFGLFD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review