Request QuoteCatalog Number: xP517656SXVSize: 0.2-1mg

Request Quote

Recombinant 60S acidic ribosomal protein P2-C (rpp203)

Recombinant 60S acidic ribosomal protein P2-C (rpp203) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP517656SXVYeast1mgQuote
EP517656SXVE. coli1mgQuote
BP517656SXVBaculovirus200ugQuote
MP517656SXVMammalian Cell200ugQuote

Protein Information

SpeciesSchizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
UniProt IDO14317
Gene Namerpp203; aka: rla6, rpp2-3; ORFs:SPAC1071.08
Protein Name60S acidic ribosomal protein P2-C
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMKYLAAYLLLTVGGKNSPSASDIESVLSTVGIESESERVEALIKELDGKDIDELIAAGNE KLATVPSGGAAAAAAPAAAGGAAPAAEEAAKEEAKEEEESDEDMGFGLFD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review