Request QuoteCatalog Number: xP020340OFKSize: 0.2-1mg

Request Quote

Recombinant 60S acidic ribosomal protein P1 (rpl-21)

Recombinant 60S acidic ribosomal protein P1 (rpl-21) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP020340OFKYeast1mgQuote
EP020340OFKE. coli1mgQuote
BP020340OFKBaculovirus200ugQuote
MP020340OFKMammalian Cell200ugQuote

Protein Information

SpeciesOscheius brevesophaga
UniProt IDO01359
Gene Namerpl-21
Protein Name60S acidic ribosomal protein P1
Region Expressed1-112
Expression Tag6xHis
Purity>90%
AA SequenceMASPQELACVYAALILQDDEVAITGDKIATLLKAANIEFEPFWPGLFAKALEGVDVKNLI TSVSSGASAGPAQAAAAAPAGGAPAAAAPAESKEGRRSQGESDDDMGFGLLD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review