Request QuoteCatalog Number: xP310601FPMSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L12P (rpl12p)

Recombinant 50S ribosomal protein L12P (rpl12p) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP310601FPMYeast1mgQuote
EP310601FPME. coli1mgQuote
BP310601FPMBaculovirus200ugQuote
MP310601FPMMammalian Cell200ugQuote

Protein Information

SpeciesSulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
UniProt IDP96040
Gene Namerpl12p; aka: rpl12Ab; Locus:SSO0342
Protein Name50S ribosomal protein L12P
Region Expressed1-106
Expression Tag6xHis
Purity>90%
AA SequenceMEYIYASLLLHSAKKEISEDALKNVLTAAGISVDEVRLKAVVAALKEVNIDEVLKNAAAM PVAVAAQPQATQAQPAAEEKKEEKKEEEKKGPSEEEIASGLASLFG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review