Request QuoteCatalog Number: xP529275NHESize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L17, chloroplastic (RPL17)

Recombinant 50S ribosomal protein L17, chloroplastic (RPL17) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529275NHEYeast1mgQuote
EP529275NHEE. coli1mgQuote
BP529275NHEBaculovirus200ugQuote
MP529275NHEMammalian Cell200ugQuote

Protein Information

SpeciesNicotiana tabacum (Common tobacco)
UniProt IDO80363
Gene NameRPL17
Protein Name50S ribosomal protein L17, chloroplastic
Region Expressed90-205
Expression Tag6xHis
Purity>90%
AA SequenceMRHGRKVPKLNRPPDQRRALLRGLTTQLLKHGRIKTTKARARAVRKYVDKMITMAKDGSL HKRRQALGFIYEKQIVHALFAEVPDRYGERNGGYTRIIRTLPRRGDNAPMAYIELV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review