Request QuoteCatalog Number: xP524232FHXSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L30e (rpl30e)

Recombinant 50S ribosomal protein L30e (rpl30e) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP524232FHXYeast1mgQuote
EP524232FHXE. coli1mgQuote
BP524232FHXBaculovirus200ugQuote
MP524232FHXMammalian Cell200ugQuote

Protein Information

SpeciesPyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
UniProt IDO74018
Gene Namerpl30e; Locus:PH1543.1; ORFs:PHS043
Protein Name50S ribosomal protein L30e
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMDLAFELKKALETGKVILGSNETIRLAKTGGAKLIIVARNAPKEIKDDIYYYAKLSDIPV YEFEGTSVELGTLLGKPFVVASLAIVDPGESRILALVKR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review