Request QuoteCatalog Number: xP526466EVKSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L23, chloroplastic (rpl23)

Recombinant 50S ribosomal protein L23, chloroplastic (rpl23) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526466EVKYeast1mgQuote
EP526466EVKE. coli1mgQuote
BP526466EVKBaculovirus200ugQuote
MP526466EVKMammalian Cell200ugQuote

Protein Information

SpeciesPicea abies (Norway spruce) (Picea excelsa)
UniProt IDO62961
Gene Namerpl23
Protein Name50S ribosomal protein L23, chloroplastic
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMDEVKYPVLTEKSIRLLERNQYTFNVDSQLNKTKMKIWIEHFFDVKVIAMNSYRLPEKGG KGGSMIGHPIRCKRMIITLKPGDSIPLFSEQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review