Request QuoteCatalog Number: xP526533DNVSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L17 (rplQ)

Recombinant 50S ribosomal protein L17 (rplQ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526533DNVYeast1mgQuote
EP526533DNVE. coli1mgQuote
BP526533DNVBaculovirus200ugQuote
MP526533DNVMammalian Cell200ugQuote

Protein Information

SpeciesAquifex aeolicus (strain VF5)
UniProt IDO66482
Gene NamerplQ; Locus:aq_069
Protein Name50S ribosomal protein L17
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMRHRVKKKHFDRTKEQRLALYRSLARALIFDERIETTVERAKALRSFIEPLVELAKEGTL HARRQALSRLPDKPAIKKLFEDIAPRFEGRNGGYVRIIKLPYRRRGDGAEMAIIEWVE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review