Request QuoteCatalog Number: xP526529DNVSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L23 (rplW)

Recombinant 50S ribosomal protein L23 (rplW) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526529DNVYeast1mgQuote
EP526529DNVE. coli1mgQuote
BP526529DNVBaculovirus200ugQuote
MP526529DNVMammalian Cell200ugQuote

Protein Information

SpeciesAquifex aeolicus (strain VF5)
UniProt IDO66433
Gene NamerplW; Locus:aq_012
Protein Name50S ribosomal protein L23
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMSQRKPWEIIIRPIITEKSNRLMEDYNKYTFEVALDASKPEIKYAVEKLFNVKVKKVNTM IVKPKKKRVWNKFRQYGTTKKWKKAIVTLEKGHKIDILEFAQK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review