Request QuoteCatalog Number: xP528135TPRSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L18 (rplR)

Recombinant 50S ribosomal protein L18 (rplR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP528135TPRYeast1mgQuote
EP528135TPRE. coli1mgQuote
BP528135TPRBaculovirus200ugQuote
MP528135TPRMammalian Cell200ugQuote

Protein Information

SpeciesTreponema pallidum (strain Nichols)
UniProt IDO83235
Gene NamerplR; Locus:TP_0205
Protein Name50S ribosomal protein L18
Region Expressed1-120
Expression Tag6xHis
Purity>90%
AA SequenceMLRKCSDKQRKRMKRKVHIRKRVYGTAVRPRMTVFRSNRNISVQVIDDDARSTLASVSTL EKDFVLLRANVSSGLQIGEEIGRRLLEKHIDTVIFDRNGYLYHGVVAAVADGARKAGVKF
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review