Request QuoteCatalog Number: xP529946MWISize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L24 (rplX)

Recombinant 50S ribosomal protein L24 (rplX) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529946MWIYeast1mgQuote
EP529946MWIE. coli1mgQuote
BP529946MWIBaculovirus200ugQuote
MP529946MWIMammalian Cell200ugQuote

Protein Information

SpeciesMycoplasma gallisepticum (strain R (low / passage 15 / clone 2) )
UniProt IDO52343
Gene NamerplX; aka: rpl24; Locus:MYCGA0620; ORFs:MGA_0728
Protein Name50S ribosomal protein L24
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMQRIKKGDKVVIIAGKHKQKTGIVLQVFVKEQRAIVEGINMVKRHTKENAQNQKGGIIEK EAPIHLSNLALLDHKAKDVRPVKVKYGTDPKTNKKVRLSRKTNNLVGGQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review