Request QuoteCatalog Number: xP526155GHGSize: 0.2-1mg

Request Quote

Recombinant 50S ribosomal protein L24, chloroplastic (rpl24)

Recombinant 50S ribosomal protein L24, chloroplastic (rpl24) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526155GHGYeast1mgQuote
EP526155GHGE. coli1mgQuote
BP526155GHGBaculovirus200ugQuote
MP526155GHGMammalian Cell200ugQuote

Protein Information

SpeciesGuillardia theta (Cryptomonas phi)
UniProt IDO46905
Gene Namerpl24
Protein Name50S ribosomal protein L24, chloroplastic
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMTIKQGDKVQVIAGSYKGEITEVLKVIRKSNSLILKNINIKNKHVKPKKEGEVGQIKQFE APIHRSNVMLYDEESQIRSRSKFIISQDGKKVRVLKKLVKN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review